PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn293421
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family ZF-HD
Protein Properties Length: 106aa    MW: 11366.5 Da    PI: 5.5956
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn293421genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer96.52.1e-3047103259
  ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                  ++vrY +C+kN+Aas+Gg+avDGC+Efm+s geegt+ al+CaACgCH +FHRrevee
   Achn293421  47 RSVRYGQCQKNQAASIGGYAVDGCREFMAS-GEEGTSGALTCAACGCHQSFHRREVEE 103
                  579**************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257744.0E-2320102IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.0E-2849101IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.8E-2450101IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.41351100IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 106 aa     Download sequence    Send to blast
MPTSDELAHQ FEGEEATEEM GKRQAVLKKN EPVSRHSCTT SSFTVMRSVR YGQCQKNQAA  60
SIGGYAVDGC REFMASGEEG TSGALTCAAC GCHQSFHRRE VEEAG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015583772.16e-37PREDICTED: mini zinc finger protein 2
SwissprotQ9LJW59e-31MIF2_ARATH; Mini zinc finger protein 2
TrEMBLB9T6Z47e-37B9T6Z4_RICCO; Transcription factor, putative
STRINGVIT_14s0108g00810.t014e-35(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11052486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.16e-32mini zinc finger 2